<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
  <BlastOutput_program>blastp</BlastOutput_program>
  <BlastOutput_version>blastp 2.2.20 [Feb-08-2009]</BlastOutput_version>
  <BlastOutput_reference>~Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, ~Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), ~&quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search~programs&quot;,  Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
  <BlastOutput_db>pdb_seqatms </BlastOutput_db>
  <BlastOutput_query-ID>lcl|1_0</BlastOutput_query-ID>
  <BlastOutput_query-def>No definition line found</BlastOutput_query-def>
  <BlastOutput_query-len>35</BlastOutput_query-len>
  <BlastOutput_param>
    <Parameters>
      <Parameters_matrix>BLOSUM62</Parameters_matrix>
      <Parameters_expect>10</Parameters_expect>
      <Parameters_gap-open>11</Parameters_gap-open>
      <Parameters_gap-extend>1</Parameters_gap-extend>
      <Parameters_filter>F</Parameters_filter>
    </Parameters>
  </BlastOutput_param>
  <BlastOutput_iterations>
    <Iteration>
      <Iteration_iter-num>1</Iteration_iter-num>
      <Iteration_query-ID>lcl|1_0</Iteration_query-ID>
      <Iteration_query-def>No definition line found</Iteration_query-def>
      <Iteration_query-len>35</Iteration_query-len>
      <Iteration_hits>
        <Hit>
          <Hit_num>1</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|74655</Hit_id>
          <Hit_def>pdbsa|1JEZ_B OXIDOREDUCTASE The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis</Hit_def>
          <Hit_accession>74655</Hit_accession>
          <Hit_len>322</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>206</Hsp_hit-from>
              <Hsp_hit-to>240</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSSFgpqsfvemnqgralntptLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSSFgpqsfvemnqgralntptLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>2</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|68332</Hit_id>
          <Hit_def>pdbsa|1K8C_A OXIDOREDUCTASE Crystal Structure Of Dimeric Xylose Reductase In Complex With Nadp(H)</Hit_def>
          <Hit_accession>68332</Hit_accession>
          <Hit_len>322</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>206</Hsp_hit-from>
              <Hsp_hit-to>240</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSSFGPQSFVemNQGRALNTPTLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSSFGPQSFVemNQGRALNTPTLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>3</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|53643</Hit_id>
          <Hit_def>pdbsa|1JEZ_A OXIDOREDUCTASE The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis</Hit_def>
          <Hit_accession>53643</Hit_accession>
          <Hit_len>322</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>206</Hsp_hit-from>
              <Hsp_hit-to>240</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSsfgpqsfvemnqgralntpTLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSsfgpqsfvemnqgralntpTLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>4</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|48067</Hit_id>
          <Hit_def>pdbsa|1Z9A_A OXIDOREDUCTASE Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ &gt;pdbsa|1Z9A_B OXIDOREDUCTASE Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ &gt;pdbsa|1Z9A_C OXIDOREDUCTASE Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ &gt;pdbsa|1Z9A_D OXIDOREDUCTASE Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+</Hit_def>
          <Hit_accession>48067</Hit_accession>
          <Hit_len>321</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>205</Hsp_hit-from>
              <Hsp_hit-to>239</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>5</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|32117</Hit_id>
          <Hit_def>pdbsa|1YE4_A OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ &gt;pdbsa|1YE4_B OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ &gt;pdbsa|1YE4_C OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ &gt;pdbsa|1YE4_D OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ &gt;pdbsa|1YE6_A OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nadp+ &gt;pdbsa|1YE6_B OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nadp+ &gt;pdbsa|1YE6_C OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nadp+ &gt;pdbsa|1YE6_D OXIDOREDUCTASE Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nadp+</Hit_def>
          <Hit_accession>32117</Hit_accession>
          <Hit_len>322</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>206</Hsp_hit-from>
              <Hsp_hit-to>240</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>6</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|29685</Hit_id>
          <Hit_def>pdbsa|1K8C_B OXIDOREDUCTASE Crystal Structure Of Dimeric Xylose Reductase In Complex With Nadp(H) &gt;pdbsa|1K8C_C OXIDOREDUCTASE Crystal Structure Of Dimeric Xylose Reductase In Complex With Nadp(H) &gt;pdbsa|1K8C_D OXIDOREDUCTASE Crystal Structure Of Dimeric Xylose Reductase In Complex With Nadp(H) &gt;pdbsa|1MI3_A OXIDOREDUCTASE 1.8 Angstrom Structure Of Xylose Reductase From Candida Tenuis In Complex With Nadh &gt;pdbsa|1MI3_B OXIDOREDUCTASE 1.8 Angstrom Structure Of Xylose Reductase From Candida Tenuis In Complex With Nadh &gt;pdbsa|1MI3_C OXIDOREDUCTASE 1.8 Angstrom Structure Of Xylose Reductase From Candida Tenuis In Complex With Nadh &gt;pdbsa|1MI3_D OXIDOREDUCTASE 1.8 Angstrom Structure Of Xylose Reductase From Candida Tenuis In Complex With Nadh</Hit_def>
          <Hit_accession>29685</Hit_accession>
          <Hit_len>322</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>206</Hsp_hit-from>
              <Hsp_hit-to>240</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>7</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|17412</Hit_id>
          <Hit_def>pdbsa|1R38_A OXIDOREDUCTASE Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase &gt;pdbsa|1R38_B OXIDOREDUCTASE Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase &gt;pdbsa|1R38_C OXIDOREDUCTASE Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase &gt;pdbsa|1R38_D OXIDOREDUCTASE Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase</Hit_def>
          <Hit_accession>17412</Hit_accession>
          <Hit_len>322</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>206</Hsp_hit-from>
              <Hsp_hit-to>240</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>8</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|16856</Hit_id>
          <Hit_def>pdbsa|1SM9_A OXIDOREDUCTASE Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad &gt;pdbsa|1SM9_B OXIDOREDUCTASE Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad &gt;pdbsa|1SM9_C OXIDOREDUCTASE Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad &gt;pdbsa|1SM9_D OXIDOREDUCTASE Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad</Hit_def>
          <Hit_accession>16856</Hit_accession>
          <Hit_len>322</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>73.1738</Hsp_bit-score>
              <Hsp_score>178</Hsp_score>
              <Hsp_evalue>4.34322e-14</Hsp_evalue>
              <Hsp_query-from>1</Hsp_query-from>
              <Hsp_query-to>35</Hsp_query-to>
              <Hsp_hit-from>206</Hsp_hit-from>
              <Hsp_hit-to>240</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>35</Hsp_identity>
              <Hsp_positive>35</Hsp_positive>
              <Hsp_align-len>35</Hsp_align-len>
              <Hsp_qseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_qseq>
              <Hsp_hseq>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_hseq>
              <Hsp_midline>FAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLF</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
        <Hit>
          <Hit_num>9</Hit_num>
          <Hit_id>gnl|BL_ORD_ID|3781</Hit_id>
          <Hit_def>pdbsa|1NP7_A LYASE Crystal Structure Analysis Of Synechocystis Sp. Pcc6803 Cryptochrome &gt;pdbsa|1NP7_B LYASE Crystal Structure Analysis Of Synechocystis Sp. Pcc6803 Cryptochrome</Hit_def>
          <Hit_accession>3781</Hit_accession>
          <Hit_len>489</Hit_len>
          <Hit_hsps>
            <Hsp>
              <Hsp_num>1</Hsp_num>
              <Hsp_bit-score>26.5646</Hsp_bit-score>
              <Hsp_score>57</Hsp_score>
              <Hsp_evalue>4.66191</Hsp_evalue>
              <Hsp_query-from>2</Hsp_query-from>
              <Hsp_query-to>32</Hsp_query-to>
              <Hsp_hit-from>27</Hsp_hit-from>
              <Hsp_hit-to>57</Hsp_hit-to>
              <Hsp_query-frame>1</Hsp_query-frame>
              <Hsp_hit-frame>1</Hsp_hit-frame>
              <Hsp_identity>12</Hsp_identity>
              <Hsp_positive>18</Hsp_positive>
              <Hsp_align-len>31</Hsp_align-len>
              <Hsp_qseq>AQKAGVTITAYSSFGPQSFVEMNQGRALNTP</Hsp_qseq>
              <Hsp_hseq>ALKSGLAITAVYCYDPRQFAQTHQGFAKTGP</Hsp_hseq>
              <Hsp_midline>A K+G+ ITA   + P+ F + +QG A   P</Hsp_midline>
            </Hsp>
          </Hit_hsps>
        </Hit>
      </Iteration_hits>
      <Iteration_stat>
        <Statistics>
          <Statistics_db-num>74799</Statistics_db-num>
          <Statistics_db-len>18469693</Statistics_db-len>
          <Statistics_hsp-len>9</Statistics_hsp-len>
          <Statistics_eff-space>4.62709e+08</Statistics_eff-space>
          <Statistics_kappa>0.041</Statistics_kappa>
          <Statistics_lambda>0.267</Statistics_lambda>
          <Statistics_entropy>0.14</Statistics_entropy>
        </Statistics>
      </Iteration_stat>
    </Iteration>
  </BlastOutput_iterations>
</BlastOutput>
